PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G01859.1.p
Common NameEUGRSUZ_G01859, LOC104453473
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 925aa    MW: 102230 Da    PI: 6.2355
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G01859.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.9e-29614664252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek+i++++l++yF++++kdAAkeLgvc+T+LKriCRq+GI+RWP+Rkik++
  Eucgr.G01859.1.p 614 EKTITVDVLRQYFAGSLKDAAKELGVCPTTLKRICRQHGIARWPSRKIKKV 664
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.677600684IPR003035RWP-RK domain
PfamPF020421.1E-25616664IPR003035RWP-RK domain
SMARTSM006666.8E-30822905IPR000270PB1 domain
PROSITE profilePS5174525.81822905IPR000270PB1 domain
SuperFamilySSF542771.68E-25822909No hitNo description
Gene3DG3DSA:3.10.20.2403.2E-24823904No hitNo description
CDDcd064071.08E-44823904No hitNo description
PfamPF005642.3E-20823904IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 925 aa     Download sequence    Send to blast
MEDGPPTPKS PFENISDDKM DLDLLDDFFL DGCWVETAAA FSLFPQSPTF AAPNEAPNHS  60
LSEETLTGIP STDSYQNAFQ EETRGNTAPG IPPSADPQTS ELAESRIQDV NSVGNATSLG  120
QVEGTEVSQS LWVAPKSSLG LSSSIKLRLM QAISHLSESS KGKDMLIQIW VPVGREGRKV  180
LTTDDQPFSL GLSSRSLQRY RSVSKSYQFQ ADDGSKDHLG LPGRAFLGKL PEWTPDVRLF  240
STEEYPRINY ARQYDVRGSL AVPVFERGSG TCLGVVEIVT TSEKINCRSD LENVCKALEA  300
VDLRSTQSFN PSIVKVDVLY EAVIPRILEA LKSVTKTYNL PLALTWASCI KQGKEGCRHS  360
DENYSLCLST MDSACLVVDL EMRGFHEACS EHHLLKGQGI VGKAFTTDKP SFSNDVTAIS  420
HTEYPLSHHA RLFRLQSALA IPVINIYTGL AEFVLELFLP KDCGDMEEGK RMLNFLCADI  480
HQAFQNSQFF TEKDLSGAIV LPFKETEIAT EKKLQKKETE VASSSRKRTS SDESSWMAHM  540
VETQTKGNGV SISSTYDMGT KEPFNITTQH QEFWHLQQDS EHITGVEGRS DSLSLSQHSR  600
GSGKDGQKRQ TKMEKTITVD VLRQYFAGSL KDAAKELGVC PTTLKRICRQ HGIARWPSRK  660
IKKVNHSLKK LQHVIDSVQG AKGTIKLGSF YESFPELSTE ISGEGPSSSK QSDPPKKTDH  720
QPDINIDNSA ATISKSPSAS CSQCSTSTTS GSNEANVHST TILASSGRND QISEDPFELL  780
KRARSHAELH EPQILARSHS HMSFDQHPLP NIQGHHLQDG LIFRVKAMFG EEKIRLVLQP  840
TWGFADLRQE IAKRFSIDDV GGIDLKYLDD DGEWVLLTCD ADLEECMDVY RTSQGHTIRM  900
SVHPASHPHR NSLGSSGHTD KRFL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G01859.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066333.10.0PREDICTED: protein NLP2-like
RefseqXP_010066334.10.0PREDICTED: protein NLP2-like
TrEMBLA0A059BDT60.0A0A059BDT6_EUCGR; Uncharacterized protein
STRINGVIT_03s0038g03710.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19982777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein